PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10031769
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family LBD
Protein Properties Length: 150aa    MW: 16412.4 Da    PI: 8.5109
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10031769genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601475.2e-46171161100
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +CaaCk+lrr+Ca+dC +apyfpa++p+kfanvhk+FGasnv k+l++l+e++r+da+ss+vyeA+ar+rdPvyG+vg i++lqqq+++l+a+la ++
  Lus10031769  17 PCAACKLLRRRCAHDCLFAPYFPADEPQKFANVHKVFGASNVNKMLQELDEHRRSDAVSSMVYEANARIRDPVYGCVGAISSLQQQVDSLQAQLAIAQ 114
                  7**********************************************************************************************999 PP

       DUF260  99 ee 100
                  +e
  Lus10031769 115 AE 116
                  76 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.56816117IPR004883Lateral organ boundaries, LOB
PfamPF031952.2E-4517114IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 150 aa     Download sequence    Send to blast
MKDGGGGGGR KSGALSPCAA CKLLRRRCAH DCLFAPYFPA DEPQKFANVH KVFGASNVNK  60
MLQELDEHRR SDAVSSMVYE ANARIRDPVY GCVGAISSLQ QQVDSLQAQL AIAQAEVVQL  120
RARNQRNAPD HHHSQHHHEA NVRESLWSS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002513395.11e-74PREDICTED: LOB domain-containing protein 4
SwissprotQ9SHE95e-64LBD4_ARATH; LOB domain-containing protein 4
TrEMBLB9RI261e-74B9RI26_RICCO; LOB domain-containing protein, putative
STRINGPOPTR_0007s08290.15e-73(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF133434105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G31320.11e-65LOB domain-containing protein 4